missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. LMBRD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

LMBRD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18362805 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18362805 100 μg 100µL
18371294 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18362805 Supplier Novus Biologicals Supplier No. NBP317880100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

LMBRD1 Polyclonal antibody specifically detects LMBRD1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen LMBRD1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias bA810I22.1, C6orf209, chromosome 6 open reading frame 209, FLJ11240, FLJ11854, HDAg-L-interacting protein NESI, hepatitis delta antigen-L interacting protein, liver regeneration p-53 related protein, LMBD1, LMBR1 domain containing 1, LMBR1 domain-containing protein 1, NESIcblF, Nuclear export signal-interacting protein, probable lysosomal cobalamin transporter
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: QYVMYGSQNYLIETNITSDNHKGNSTLSVPKRCDADAPEDQCTVTRTYLFLHKFW
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 55788
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.