missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LLPH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54933
This item is not returnable.
View return policy
Description
LLPH Polyclonal specifically detects LLPH in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| LLPH | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| C12orf31, Chromosome 12 Open Reading Frame 31, CPERP-G, HLLP, Human LAPS18-Like Protein, LLP Homolog, Long-Term Synaptic Facilitation, LLP Homolog, Long-Term Synaptic Facilitation (Aplysia), Protein LAPS18-Like, Protein LLP Homolog | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 84298 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| LLPH | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction