missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIX1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LIX1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LIX1 Polyclonal specifically detects LIX1 in Human samples. It is validated for Western Blot.Specifications
| LIX1 | |
| Polyclonal | |
| Rabbit | |
| Q8N485 | |
| 167410 | |
| Synthetic peptides corresponding to LIX1(Lix1 homolog (chicken)) The peptide sequence was selected from the N terminal of LIX1. Peptide sequence TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C5orf11, chromosome 5 open reading frame 11, FLJ25534, limb expression 1, Lix1 homolog (chicken), Lix1 homolog (mouse), protein limb expression 1 homolog | |
| LIX1 | |
| IgG | |
| 32 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title