Livin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56859-25ul

Product Code. 18678536

Description

Livin Polyclonal specifically detects Livin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Livin
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: baculoviral IAP repeat containing 7, baculoviral IAP repeat-containing 7, KIAPRING finger protein 50, Kidney inhibitor of apoptosis protein, Livin, livin inhibitor-of-apoptosis, Melanoma inhibitor of apoptosis protein, MLIAPlivin inhibitor of apoptosis, ML-IAPmliap, RNF50LIVINbaculoviral IAP repeat-containing protein 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BIRC7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE
• Quantity: 25 μL
• Research Discipline: Apoptosis, Zinc Finger
• Gene ID (Entrez): 79444
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only