missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lipolysis Stimulated Lipoprotein Receptor Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17879-100UL
This item is not returnable.
View return policy
Description
Lipolysis Stimulated Lipoprotein Receptor Polyclonal antibody specifically detects Lipolysis Stimulated Lipoprotein Receptor in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
| Lipolysis Stimulated Lipoprotein Receptor | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| ILDR3, immunoglobulin-like domain containing receptor 3, lipolysis stimulated lipoprotein receptor, lipolysis-stimulated lipoprotein receptor, lipolysis-stimulated receptor, lipolysis-stimulated remnant, LISCH, LISCH protein, LISCH7, liver-specific bHLH-Zip transcription factor, MGC10659, MGC48312, MGC48503 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSM | |
| 100 μg | |
| Endocrinology, Signal Transduction | |
| 51599 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction