LIPJ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-14195

Code produit. 18002928

Description

LIPJ Polyclonal specifically detects LIPJ in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

• Antigen: LIPJ
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: bA425M17.2, FLJ11218, lipase J, lipase member J, lipase, family member J, lipase-like abhydrolase domain-containing protein 1, lipase-like, ab-hydrolase domain containing 1, LIPL1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 142910
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LIPJ
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQD
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only