missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIPJ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LIPJ |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LIPJ Polyclonal specifically detects LIPJ in Human samples. It is validated for Western Blot.Specifications
| LIPJ | |
| Polyclonal | |
| Rabbit | |
| bA425M17.2, FLJ11218, lipase J, lipase member J, lipase, family member J, lipase-like abhydrolase domain-containing protein 1, lipase-like, ab-hydrolase domain containing 1, LIPL1 | |
| LIPJ | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 142910 | |
| Synthetic peptides corresponding to LIPJ(lipase, family member J) The peptide sequence was selected from the C terminal of LIPJ. Peptide sequence LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title