LINGO3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55062-25ul

Product Code. 18664487

Description

LINGO3 Polyclonal specifically detects LINGO3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: LINGO3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: hCG2040376, LERN2, Leucine Rich Repeat And Ig Domain Containing 3, Leucine Rich Repeat Neuronal 6B, Leucine-Rich Repeat And Immunoglobulin-Like Domain-Containing Nogo, Leucine-Rich Repeat Neuronal Protein 2, Leucine-Rich Repeat Neuronal Protein 6B, LRRN6B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 645191
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: LINGO3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only