missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
LINGO-2 Polyclonal specifically detects LINGO-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | LINGO-2 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | LERN3FLJ31810, leucine rich repeat and Ig domain containing 2, leucine-rich repeat and immunoglobulin-like domain-containing nogoreceptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C, LRRN6Cleucine rich repeat neuronal 6C |
| Gene Symbols | LINGO2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMY |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?