missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIN9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LIN9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LIN9 Polyclonal specifically detects LIN9 in Human samples. It is validated for Western Blot.Specifications
| LIN9 | |
| Polyclonal | |
| Rabbit | |
| BARA, BARPsv, hLin-9, huLin-9, Lin-9, lin-9 homolog (C. elegans), pRB-associated protein, protein lin-9 homolog, rb related pathway actor, TGS1, TGSBeta subunit-associated regulator of apoptosis, TUDOR gene similar protein, Type I interferon receptor beta chain-associated protein | |
| LIN9 | |
| IgG | |
| 53 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 286826 | |
| Synthetic peptide directed towards the N terminal of human LIN9The immunogen for this antibody is LIN9. Peptide sequence TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title