missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17789-25UL
This item is not returnable.
View return policy
Description
LIM1 Polyclonal antibody specifically detects LIM1 in Human samples. It is validated for Immunofluorescence
Specifications
| LIM1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| hLim-1, Homeobox protein Lim-1, LIM homeobox 1, LIM homeobox protein 1, LIM-1LIM/homeobox protein Lhx1, LIM1MGC138141, MGC126723 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: FVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNL | |
| 25 μg | |
| DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience | |
| 3975 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction