missing translation for 'onlineSavingsMsg'
Learn More

LIM domain only 3 Antibody (4C4), Novus Biologicals™

Product Code. 18373929 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18373929 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18373929 Supplier Novus Biologicals Supplier No. H00055885M08

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

LIM domain only 3 Monoclonal antibody specifically detects LIM domain only 3 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen LIM domain only 3
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 4C4
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_061110
Gene Alias DAT1, LIM domain only 3 (rhombotin-like 2), LMO-3, neuronal specific transcription factor DAT1, Neuronal-specific transcription factor DAT1, RBTN3, RBTNL2MGC26081, Rhom-3, RHOM3LIM domain only protein 3, rhombotin-3, rhombotin-like 2
Host Species Mouse
Immunogen LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55885
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.