missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LIAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C17orf97 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LIAT1 Polyclonal specifically detects LIAT1 in Human samples. It is validated for Western Blot.Specifications
| C17orf97 | |
| Polyclonal | |
| Rabbit | |
| chromosome 17 open reading frame 97, hypothetical protein LOC400566 | |
| C17orf97 | |
| IgG | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 400566 | |
| Synthetic peptides corresponding to LOC400566(hypothetical gene supported by AK128660) The peptide sequence was selected from the N terminal of LOC400566. Peptide sequence VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title