missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LHX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55153-25ul
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
LHX2 Polyclonal specifically detects LHX2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Tekniske data
| LHX2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| hLhx2, Homeobox protein LH-2, LH-2, LH2MGC138390, LIM homeobox 2, LIM homeobox protein 2, LIM HOX gene 2, LIM/homeobox protein Lhx2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9355 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| LHX2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYN | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction