missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Leukotriene B4 Receptor 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | Leukotriene B4 Receptor 2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18316655
|
Novus Biologicals
NBP3-09429-25UL |
25 μg |
£161.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18333496
|
Novus Biologicals
NBP3-09429-100UL |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
Leukotriene B4 Receptor 2 Polyclonal specifically detects Leukotriene B4 Receptor 2 in Human samples. It is validated for Western Blot.Spezifikation
| Leukotriene B4 Receptor 2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR, Immunology, Innate Immunity | |
| PBS buffer, 2% sucrose | |
| 56413 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human Leukotriene B4 Receptor 2. Peptide sequence TRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGP | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts