missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Leukotriene B4 Receptor 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Leukotriene B4 Receptor 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18316655 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18316655 25 μg 25µL
18333496 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18316655 Supplier Novus Biologicals Supplier No. NBP30942925UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Leukotriene B4 Receptor 2 Polyclonal specifically detects Leukotriene B4 Receptor 2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Leukotriene B4 Receptor 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human Leukotriene B4 Receptor 2. Peptide sequence TRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGP
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline GPCR, Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 56413
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.