Leukotriene B4 Receptor 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09429-25UL

Product Code. 18316655

Description

Leukotriene B4 Receptor 2 Polyclonal specifically detects Leukotriene B4 Receptor 2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Leukotriene B4 Receptor 2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Leukotriene B4 Receptor 2. Peptide sequence TRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGP
• Quantity: 25 μg
• Research Discipline: GPCR, Immunology, Innate Immunity
• Gene ID (Entrez): 56413
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified