missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Leukotriene B4 Receptor 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89960
This item is not returnable.
View return policy
Description
Leukotriene B4 Receptor 2 Polyclonal specifically detects Leukotriene B4 Receptor 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Leukotriene B4 Receptor 2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| LTB4R2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR | |
| 0.1 mL | |
| GPCR, Immunology, Innate Immunity | |
| 56413 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction