LETM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18466320	Novus Biologicals NBP1-83563-25ul	25 μL
18256947	Novus Biologicals NBP1-83563	0.1 mL

Description

LETM2 Polyclonal specifically detects LETM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LETM2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 137994
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: FLJ25409, LETM1 and EF-hand domain-containing protein 2, LETM1 domain-containing protein LETM2, mitochondrial, leucine zipper-EF-hand containing transmembrane protein 1-like protein, leucine zipper-EF-hand containing transmembrane protein 2, Leucine zipper-EF-hand-containing transmembrane protein 1-like
• Gene Symbols: LETM2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only