missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LETM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LETM2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LETM2 Polyclonal specifically detects LETM2 in Human samples. It is validated for Western Blot.Specifications
| LETM2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ25409, LETM1 and EF-hand domain-containing protein 2, LETM1 domain-containing protein LETM2, mitochondrial, leucine zipper-EF-hand containing transmembrane protein 1-like protein, leucine zipper-EF-hand containing transmembrane protein 2, Leucine zipper-EF-hand-containing transmembrane protein 1-like | |
| LETM2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q2VYF4-3 | |
| 137994 | |
| Synthetic peptides corresponding to LETM2(leucine zipper-EF-hand containing transmembrane protein 2) The peptide sequence was selected from the N terminal of LETM2. Peptide sequence KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title