missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LEDGF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87885-25ul
This item is not returnable.
View return policy
Description
LEDGF Polyclonal specifically detects LEDGF in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| LEDGF | |
| Polyclonal | |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| CLL-associated antigen KW-7, Dense fine speckles 70 kDa protein, DFS70, LEDGFDFS 70, Lens epithelium-derived growth factor, MGC74712, p52, p75, PAIP, PC4 and SFRS1 interacting protein 1, PC4 and SFRS1 interacting protein 2, PC4 and SFRS1-interacting protein, PSIP2, transcriptional coactivator p52/p75, Transcriptional coactivator p75/p52 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PSIP1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ | |
| 25 μL | |
| ABC Transporters, Alzheimers Research, Neuroscience | |
| 11168 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction