LEDGF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-87885

Product Code. 18296568

Description

LEDGF Polyclonal specifically detects LEDGF in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LEDGF
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: CLL-associated antigen KW-7, Dense fine speckles 70 kDa protein, DFS70, LEDGFDFS 70, Lens epithelium-derived growth factor, MGC74712, p52, p75, PAIP, PC4 and SFRS1 interacting protein 1, PC4 and SFRS1 interacting protein 2, PC4 and SFRS1-interacting protein, PSIP2, transcriptional coactivator p52/p75, Transcriptional coactivator p75/p52
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PSIP1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ
• Quantity: 0.1 mL
• Research Discipline: ABC Transporters, Alzheimers Research, Neuroscience
• Gene ID (Entrez): 11168
• Target Species: Human
• Isotype: IgG

For Research Use Only