missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18352089

LEDGF Antibody (3H1), Novus Biologicals™

Product Code. 18352089 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18352089 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18352089 Supplier Novus Biologicals Supplier No. H00011168M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

LEDGF Monoclonal antibody specifically detects LEDGF in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen LEDGF
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 3H1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH33817
Gene Alias CLL-associated antigen KW-7, Dense fine speckles 70 kDa protein, DFS70, LEDGFDFS 70, Lens epithelium-derived growth factor, MGC74712, p52, p75, PAIP, PC4 and SFRS1 interacting protein 1, PC4 and SFRS1 interacting protein 2, PC4 and SFRS1-interacting protein, PSIP2, transcriptional coactivator p52/p75, Transcriptional coactivator p75/p52
Host Species Mouse
Immunogen PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline ABC Transporters, Alzheimers Research, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 11168
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.