missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LCN8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LCN8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LCN8 Polyclonal specifically detects LCN8 in Human samples. It is validated for Western Blot.Specifications
| LCN8 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| chromosome 9 open reading frame 137, EP17, epididymal-specific lipocalin-8, LCN5, lipocalin 5, lipocalin 8 | |
| LCN8 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A1L4A8 | |
| 138307 | |
| Synthetic peptides corresponding to LCN8(lipocalin 8) The peptide sequence was selected from the N terminal of LCN8. Peptide sequence EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title