missing translation for 'onlineSavingsMsg'
Learn More

LCAT Antibody, Novus Biologicals™

Product Code. 18605160 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18605160 25 μL 25µL
18322330 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18605160 Supplier Novus Biologicals Supplier No. NBP27653725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

LCAT Polyclonal specifically detects LCAT in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LCAT
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias EC 2.3.1.43, lecithin-cholesterol acyltransferasePhospholipid-cholesterol acyltransferase, phosphatidylcholine-sterol acyltransferase
Gene Symbols LCAT
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYF
Purification Method Affinity Purified
Quantity 25 μL
Research Discipline Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3931.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.