missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LATS1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33348-100ul
This item is not returnable.
View return policy
Description
LATS1 Monoclonal antibody specifically detects LATS1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| LATS1 | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| EC 2.7.11, h-warts, Large tumor suppressor homolog 1, LATS (large tumor suppressor, Drosophila) homolog 1, LATS, large tumor suppressor, homolog 1 (Drosophila), serine/threonine-protein kinase LATS1, WARTS protein kinase, WARTSEC 2.7.11.1, wts | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LATS1 (NP_004681.1).,, Sequence:, MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSE | |
| 100 μL | |
| Apoptosis, Cancer, Cell Cycle and Replication, Mitotic Regulators, Tumor Suppressors | |
| 9113 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction