LATS1 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33348-20ul

Product Code. 30232645

Description

LATS1 Monoclonal antibody specifically detects LATS1 in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: LATS1
• Classification: Monoclonal
• Dilution: Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: EC 2.7.11, h-warts, Large tumor suppressor homolog 1, LATS (large tumor suppressor, Drosophila) homolog 1, LATS, large tumor suppressor, homolog 1 (Drosophila), serine/threonine-protein kinase LATS1, WARTS protein kinase, WARTSEC 2.7.11.1, wts
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LATS1 (NP_004681.1).,, Sequence:, MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSE
• Quantity: 20 μL
• Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Mitotic Regulators, Tumor Suppressors
• Gene ID (Entrez): 9113
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified