missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18409189

LASS4 Antibody (7D1), Novus Biologicals™

Product Code. 18409189 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18409189 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18409189 Supplier Novus Biologicals Supplier No. H00079603M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

LASS4 Monoclonal antibody specifically detects LASS4 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen LASS4
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 7D1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_078828
Gene Alias CerS4, FLJ12089, LAG1 homolog, ceramide synthase 4, LAG1 longevity assurance homolog 4, LAG1 longevity assurance homolog 4 (S. cerevisiae), Trh1
Host Species Mouse
Immunogen LASS4 (NP_078828, 57 a.a. ∽ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79603
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.