missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LASS4 Antibody (4B10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00079603-M02
This item is not returnable.
View return policy
Description
LASS4 Monoclonal antibody specifically detects LASS4 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| LASS4 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| CerS4, FLJ12089, LAG1 homolog, ceramide synthase 4, LAG1 longevity assurance homolog 4, LAG1 longevity assurance homolog 4 (S. cerevisiae), Trh1 | |
| LASS4 (NP_078828, 57 a.a. ∽ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 4B10 | |
| Western Blot 1:500, ELISA, Sandwich ELISA | |
| NP_078828 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 79603 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction