missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LARP7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | LARP7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
LARP7 Polyclonal specifically detects LARP7 in Human samples. It is validated for Western Blot.Specifications
| LARP7 | |
| Polyclonal | |
| Purified | |
| RUO | |
| 51574 | |
| Synthetic peptides corresponding to LARP7 (La ribonucleoprotein domain family, member 7) The peptide sequence was selected from the C terminal of LARP7. Peptide sequence HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| DKFZp564K112, HDCMA18P, La ribonucleoprotein domain family member 7, La ribonucleoprotein domain family, member 7, la-related protein 7, PIP7SMGC104360, P-TEFb-interaction protein for 7SK stability | |
| LARP7 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title