missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LARP6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | LARP6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18291923
|
Novus Biologicals
NBP2-55021 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18614408
|
Novus Biologicals
NBP2-55021-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LARP6 Polyclonal specifically detects LARP6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| LARP6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Acheron, Achn, death-associated LA motif protein, FLJ11196, La ribonucleoprotein domain family member 6, La ribonucleoprotein domain family, member 6, la-related protein 6 | |
| LARP6 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 55323 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title