missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LARGE Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59946
This item is not returnable.
View return policy
Description
LARGE Polyclonal specifically detects LARGE in Human samples. It is validated for Western Blot.
Specifications
| LARGE | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Acetylglucosaminyltransferase-like 1A, EC 2.4, glycosyltransferase-like protein LARGE1, KIAA0609acetylglucosaminyltransferase-like protein, LARGE1, like-acetylglucosaminyltransferase, like-glycosyltransferase, MDC1D, MDDGA6, MDDGB6 | |
| Rabbit | |
| 88 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O95461 | |
| LARGE | |
| Synthetic peptides corresponding to LARGE(like-glycosyltransferase) The peptide sequence was selected from the middle region of LARGE (NP_004728). Peptide sequence AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE. | |
| Affinity purified | |
| RUO | |
| 9215 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto