missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LAP1B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17660-25UL
This item is not returnable.
View return policy
Description
LAP1B Polyclonal antibody specifically detects LAP1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| LAP1B | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp586G011, FLJ13142, lamina associated polypeptide 1B, lamina-associated polypeptide 1B, LAP1B, MGC3413, torsin A interacting protein 1, torsin-1A-interacting protein 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 26092 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction