missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LANCL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | LANCL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LANCL3 Polyclonal specifically detects LANCL3 in Human samples. It is validated for Western Blot.Specifications
| LANCL3 | |
| Polyclonal | |
| Rabbit | |
| NP_940913 | |
| 347404 | |
| Synthetic peptide directed towards the C terminal of human LANCL3. Peptide sequence ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ42925, LanC lantibiotic synthetase component C-like 3 (bacterial) | |
| LANCL3 | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title