missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18386787

Laminin gamma 1 Antibody (2E6-B4), Novus Biologicals™

Product Code. 18386787 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18386787 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18386787 Supplier Novus Biologicals Supplier No. H00003915M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Laminin gamma 1 Monoclonal antibody specifically detects Laminin gamma 1 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Laminin gamma 1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2E6-B4
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH15586
Gene Alias LAMB2Laminin-7 subunit gamma, Laminin B2 chain, laminin subunit gamma-1, laminin, gamma 1 (formerly LAMB2), Laminin-1 subunit gamma, Laminin-10 subunit gamma, Laminin-11 subunit gamma, Laminin-2 subunit gamma, Laminin-3 subunit gamma, Laminin-4 subunit gamma, Laminin-6 subunit gamma, Laminin-8 subunit gamma, Laminin-9 subunit gamma, MGC87297, S-LAM gamma, S-laminin subunit gamma
Host Species Mouse
Immunogen LAMC1 (AAH15586, 1 a.a. ~ 38 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 3915
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.