missing translation for 'onlineSavingsMsg'
Learn More

Laminin alpha 4 Antibody, Novus Biologicals™

Product Code. 18339577 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Conditionnement:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18339577 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18339577 Fournisseur Novus Biologicals Code fournisseur H00003910D01P

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

Laminin alpha 4 Polyclonal antibody specifically detects Laminin alpha 4 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigen Laminin alpha 4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH04241.1
Gene Alias DKFZp686D23145, LAMA3LAMA4*-1, laminin alpha 4 chain, laminin subunit alpha-4, laminin, alpha 4, Laminin-14 subunit alpha, Laminin-8 subunit alpha, Laminin-9 subunit alpha
Host Species Rabbit
Immunogen LAMA4 (AAH04241.1, 1 a.a. - 120 a.a.) full-length human protein. MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3910
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.