missing translation for 'onlineSavingsMsg'
Learn More

Laminin alpha 3 Antibody (CL3112), Novus Biologicals™

Mouse Monoclonal Antibody

£294.00 - £444.00

Specifications

Antigen	Laminin alpha 3
Clone	CL3112
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18620038 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-42390-25ul	25 μL	£294.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18655847 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-42390	0.1 mL	£444.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Laminin alpha 3 Monoclonal antibody specifically detects Laminin alpha 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	Laminin alpha 3
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	Q16787
Gene ID (Entrez)	3909
Isotype	IgG1
Purification Method	Protein A purified

Clone	CL3112
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Research Discipline	Signal Transduction
Formulation	PBS (pH 7.2), 40% Glycerol
Gene Alias	BM600, BM600 150kD subunit, BM600-150kDa, E170, epiligrin, Epiligrin 170 kDa subunit, epiligrin alpha 3 subunit, Epiligrin subunit alpha, kalinin 165kD subunit, Kalinin subunit alpha, kalinin-165kDa, lama3a, laminin subunit alpha-3, laminin, alpha 3, laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin), laminin-5 alpha 3 chain, Laminin-5 subunit alpha, Laminin-6 subunit alpha, Laminin-7 subunit alpha, LAMNA, LOCS, nicein 150kD subunit, Nicein subunit alpha, nicein-150kDa
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Laminin alpha 3 Antibody (CL3112), Novus Biologicals™

Specifications

Description

Specifications

Documents