missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Laforin/EPM2A Monoclonal antibody specifically detects Laforin/EPM2A in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunoprecipitation, ELISA
Specifications
Specifications
| Antigen | Laforin/EPM2A |
| Applications | Western Blot, ELISA, Immunoprecipitation, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 6C6 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_001018051 |
| Gene Alias | EC 3.1.3.16, EC 3.1.3.48, epilepsy, progressive myoclonus type 2, Lafora disease (laforin), epilepsy, progressive myoclonus type 2A, Lafora disease (laforin), EPM2, Lafora PTPase, laforin, LAFPTPase, LD, LDE, MELF |
| Host Species | Mouse |
| Immunogen | EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?