missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lactate Dehydrogenase C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35491-100ul
This item is not returnable.
View return policy
Description
Lactate Dehydrogenase C Polyclonal antibody specifically detects Lactate Dehydrogenase C in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| Lactate Dehydrogenase C | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:100 | |
| Cancer/testis antigen 32, CT32EC 1.1.1.27, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Lactate Dehydrogenase C (NP_002292.1).,, Sequence:, ISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSW | |
| 100 μL | |
| Cellular Markers | |
| 3948 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction