Lactate Dehydrogenase C Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33212-100ul

Product Code. 30232067

Description

Lactate Dehydrogenase C Monoclonal antibody specifically detects Lactate Dehydrogenase C in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: Lactate Dehydrogenase C
• Classification: Monoclonal
• Dilution: Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: Cancer/testis antigen 32, CT32EC 1.1.1.27, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lactate Dehydrogenase C (P07864).,, Sequence:, MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQ
• Quantity: 100 μL
• Research Discipline: Cellular Markers
• Gene ID (Entrez): 3948
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified