missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lactate Dehydrogenase B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55415
This item is not returnable.
View return policy
Description
Lactate Dehydrogenase B Polyclonal specifically detects Lactate Dehydrogenase B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
Specifications
| EC 1.1.1, EC 1.1.1.27, lactate dehydrogenase B, LDH heart subunit, LDH-B, LDH-H, L-lactate dehydrogenase B chain, Renal carcinoma antigen NY-REN-46, TRG-5 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lactate Dehydrogenase B. Peptide Sequence MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD. The peptide sequence for this immunogen was taken from within the described region. | |
| Bovine, Equine |
| Rabbit | |
| 37 kDa |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction