missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR37L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49419
This item is not returnable.
View return policy
Description
GPR37L1 Polyclonal antibody specifically detects GPR37L1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| GPR37L1 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| endothelin B receptor-like protein 2, ET(B)R-LP-2, ETBRLP2, ETBR-LP-2endothelin type b receptor-like protein 2, G protein-coupled receptor 37 like 1, G-protein coupled receptor 37 like 1, G-protein coupled receptor 37-like 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS | |
| 0.1 mL | |
| GPCR, Neuroscience, Signal Transduction | |
| 9283 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction