missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. L-Selectin/CD62L Antibody, Novus Biologicals™

L-Selectin/CD62L Antibody, Novus Biologicals™

Product Code. 18393961 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18393961 100 μL 100µL
18656660 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18393961 Supplier Novus Biologicals Supplier No. NBP276545

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

L-Selectin/CD62L Polyclonal specifically detects L-Selectin/CD62L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen L-Selectin/CD62L
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias CD62L, CD62L antigen, gp90-MEL, hLHRc, LAM-1, LAM1LECAM1, Leu-8, LEU8, Leukocyte adhesion molecule 1, Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1, LNHRTQ1, LSEL, L-selectin, Lyam-1, LYAM1CD62 antigen-like family member L, Lymph node homing receptor, lymphocyte adhesion molecule 1, pln homing receptor, PLNHR, selectin L
Gene Symbols SELL
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD
Purification Method Affinity Purified
Quantity 100 μL
Research Discipline Adaptive Immunity, B Cell Development and Differentiation Markers, Cardiovascular Biology, Glycobiology, Immunology, Lipid and Metabolism, Myeloid derived Suppressor Cell, Signal Transduction, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 6402.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.