missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KvBeta2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80097
This item is not returnable.
View return policy
Description
KvBeta2 Polyclonal antibody specifically detects KvBeta2 in Human, Mouse samples. It is validated for Western Blot.
Specifications
| KvBeta2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| HKvbeta2, HKvbeta2.1, HKvbeta2.2, K(+) channel subunit beta-2, K+ channel beta-2 subunit, KCNA2BAKR6A5, KCNK2, KV-BETA-2, MGC117289, potassium channel shaker chain beta 2, potassium voltage-gated channel, shaker-related subfamily, beta member 2, voltage-gated potassium channel subunit beta-2 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Predicted Homology based on Immunogen Sequence: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%. NOTE: The immunogen sequence of this antibody has 100% homology with Rat and Mouse, however, this antibody did not detect Rat/Mouse's KvBeta2 in WB assay (varified customer's feedback). | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_742128 | |
| KCNAB2 | |
| Synthetic peptide directed towards the C terminal of human KCNAB2. Peptide sequence KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL. | |
| 100 μL | |
| Signal Transduction | |
| 8514 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction