KvBeta2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80097

Product Code. 18228155

Description

KvBeta2 Polyclonal antibody specifically detects KvBeta2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: KvBeta2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HKvbeta2, HKvbeta2.1, HKvbeta2.2, K(+) channel subunit beta-2, K+ channel beta-2 subunit, KCNA2BAKR6A5, KCNK2, KV-BETA-2, MGC117289, potassium channel shaker chain beta 2, potassium voltage-gated channel, shaker-related subfamily, beta member 2, voltage-gated potassium channel subunit beta-2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Predicted Homology based on Immunogen Sequence: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%. NOTE: The immunogen sequence of this antibody has 100% homology with Rat and Mouse, however, this antibody did not detect Rat/Mouse's KvBeta2 in WB assay (varified customer's feedback).
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_742128
• Gene Symbols: KCNAB2
• Immunogen: Synthetic peptide directed towards the C terminal of human KCNAB2. Peptide sequence KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 8514
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only