missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv6.4 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10369-100UL
This item is not returnable.
View return policy
Description
Kv6.4 Polyclonal specifically detects Kv6.4 in Rat samples. It is validated for Western Blot.
Specifications
| Kv6.4 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| KV6.3, KV6.4, MGC129609, potassium voltage-gated channel, subfamily G, member 4, voltage-gated potassium channel Kv6.3, voltage-gated potassium channel subunit Kv6.4 | |
| The immunogen is a synthetic peptide directed towards the middle region of RAT Kv6.4 (NP_001100905). Peptide sequence SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL | |
| 100 μg | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 93107 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction