missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv5.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £444.00
Specifications
| Antigen | Kv5.1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18478140
|
Novus Biologicals
NBP1-81605-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18020654
|
Novus Biologicals
NBP1-81605 |
0.1 mL |
£444.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Kv5.1 Polyclonal specifically detects Kv5.1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Kv5.1 | |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| IK8, kH1, KV5.1, MGC33316, potassium channel KH1, potassium channel Kv5.1, potassium voltage-gated channel subfamily F member 1, potassium voltage-gated channel, subfamily F, member 1, voltage-gated potassium channel subunit Kv5.1 | |
| KCNF1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3754 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title