Kv4.1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55128

Product Code. 18249491

Beskrivning

Kv4.1 Polyclonal specifically detects Kv4.1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifikationer

• Antigen: Kv4.1
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Kv4.1, potassium voltage-gated channel subfamily D member 1, potassium voltage-gated channel, Shal-related subfamily, member 1, shal-type potassium channel, voltage-gated potassium channel Kv4.1, Voltage-gated potassium channel subunit Kv4.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3750
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KCND1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NTLDRYPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQ
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only