missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv4.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Kv4.1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Kv4.1 Polyclonal specifically detects Kv4.1 in Mouse samples. It is validated for Western Blot.Specifications
| Kv4.1 | |
| Polyclonal | |
| Rabbit | |
| Q03719 | |
| 3750 | |
| Synthetic peptides corresponding to the N terminal of Kcnd1. Immunizing peptide sequence MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Kv4.1, potassium voltage-gated channel subfamily D member 1, potassium voltage-gated channel, Shal-related subfamily, member 1, shal-type potassium channel, voltage-gated potassium channel Kv4.1, Voltage-gated potassium channel subunit Kv4.1 | |
| KCND1 | |
| IgG | |
| 75 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title