missing translation for 'onlineSavingsMsg'
Learn More

Kv3.3 Antibody (6F7), Novus Biologicals™

Product Code. 18339788 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18339788 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18339788 Supplier Novus Biologicals Supplier No. H00003748M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Kv3.3 Monoclonal antibody specifically detects Kv3.3 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Kv3.3
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 6F7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004968
Gene Alias KSHIIID, KV3.3, potassium voltage-gated channel subfamily C member 3, potassium voltage-gated channel, Shaw-related subfamily, member 3, SCA13, Shaw-related voltage-gated potassium channel protein 3, spinocerebellar ataxia 13, voltage-gated potassium channel protein KV3.3, Voltage-gated potassium channel subunit Kv3.3
Host Species Mouse
Immunogen KCNC3 (NP_004968, 671 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuronal Cell Markers, Neuroscience, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 3748
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.