Kv12.2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-14142

Codice prodotto. 18023459

Descrizione

Kv12.2 Polyclonal specifically detects Kv12.2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifica

• Antigen: Kv12.2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: BEC1, brain-specific eag-like channel 1, ELK channel 2, ELK2, ether-a-go-go K(+) channel family member, ether-a-go-go-like potassium channel 2, KIAA1282, Kv12.2, potassium voltage-gated channel subfamily H member 3, potassium voltage-gated channel, subfamily H (eag-related), member 3, voltage-gated potassium channel subunit Kv12.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KCNH3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 23416
• Target Species: Human
• Isotype: IgG

For Research Use Only