missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv12.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17510-100UL
This item is not returnable.
View return policy
Description
Kv12.1 Polyclonal antibody specifically detects Kv12.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Kv12.1 | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| ELK, ELK channel 3, ELK1, ELK3, ether-a-go-go-like potassium channel 1, Ether-a-go-go-like potassium channel 3, hElk1, Kv12.1, potassium voltage-gated channel subfamily H member 8, potassium voltage-gated channel, subfamily H (eag-related), member 8, Voltage-gated potassium channel subunit Kv12.1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: RCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKA | |
| 100 μg | |
| Signal Transduction | |
| 131096 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu