Kv12.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17510-100UL

Product Code. 18311627

Description

Kv12.1 Polyclonal antibody specifically detects Kv12.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Kv12.1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: ELK, ELK channel 3, ELK1, ELK3, ether-a-go-go-like potassium channel 1, Ether-a-go-go-like potassium channel 3, hElk1, Kv12.1, potassium voltage-gated channel subfamily H member 8, potassium voltage-gated channel, subfamily H (eag-related), member 8, Voltage-gated potassium channel subunit Kv12.1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKA
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 131096
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified